PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_21140V3.1.p
Common NameGlk2, PHYPADRAFT_178653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family G2-like
Protein Properties Length: 518aa    MW: 56232.6 Da    PI: 4.694
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_21140V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.23.2e-27226280156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k++++WtpeLH+rFv+aveqL G ekA P++ilelm+v++Lt+++++SHLQkYR++
  Pp3c11_21140V3.1.p 226 KAKVDWTPELHRRFVHAVEQL-GVEKAYPSRILELMGVQCLTRHNIASHLQKYRSH 280
                         6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.533223282IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-27224283IPR009057Homeodomain-like
SuperFamilySSF466897.17E-18224282IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-25226280IPR006447Myb domain, plants
PfamPF002495.5E-7229278IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MAMDMARIDE STAVEVNSLS LVHCVLDGLP DSPCLKSSPT SFEEAVAEGR SVFGDEEDII  60
NNSNDQDNSS SCGAVVTTHE DFAECLNFVT EAECGDVGVR CFEDFDKLPD CGDEGETSKA  120
EEEGCVRIGG GGEQGELLES VSLDCSRNSE NLELRDLGEL WEGSERPDSV PGNEVGEEEA  180
LLLAEAAKAT GDVVSASDSG ECSSVDRKDN QASPKSSKNA APGKKKAKVD WTPELHRRFV  240
HAVEQLGVEK AYPSRILELM GVQCLTRHNI ASHLQKYRSH RRHLAAREAE AASWTHRRTY  300
TQAPWPRSSR RDGLPYLVPI HTPHIQPRPS MAMAMQPQLQ TPHHPISTPL KVWGYPTVDH  360
SNVHMWQQPA VATPSYWQAA DGSYWQHPAT GYDAFSARAC YSHPMQRVPV TTTHAGLPIV  420
APGFPDESCY YGDDMLAGSM YLCNQSYDSE IGRAAGVAAC SKPIETHLSK EVLDAAIGEA  480
LANPWTPPPL GLKPPSMEGV IAELQRQGIN TVPPSTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-16223278257ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.86000.0gametophore| protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7416850.0AY741685.1 Physcomitrella patens golden 2-like protein 2 (Glk2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001758270.10.0predicted protein
TrEMBLQ5IFL60.0Q5IFL6_PHYPA; Golden 2-like protein 2
STRINGPP1S31_317V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-42GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Yasumura Y,Moylan EC,Langdale JA
    A conserved transcription factor mediates nuclear control of organelle biogenesis in anciently diverged land plants.
    Plant Cell, 2005. 17(7): p. 1894-907
    [PMID:15923345]
  2. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]